2. Neurological Disease

Neurological Disease

Neurological Disease

Related Products

PDF 88.0 MB

A range of neurological disorders, including epilepsy and dystonia, may involve dysfunctional intracortical inhibition, and may respond to treatments that modify it. Parkinson’s is a neurodegenerative disease characterized by increased activity of GABA in basal ganglia and the loss of dopamine in nigrostriatum, associated with rigidity, resting tremor, gait with accelerating steps, and fixed inexpressive face. Neurological deficits, along with neuromuscular involvement, are characteristic of mitochondrial disease, and these symptoms can have a dramatic impact on patient quality of life. Neurological features may be manifold, ranging from neural deafness, ataxia, peripheral neuropathy, migraine, seizures, stroke‐like episodes and dementia and depend on the part of the nervous system affected.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-120024
    BMS-986188 1776115-10-6 99.06%
    BMS-986188 is a selective positive allosteric modulator of δ-opioid receptor with an EC50 of 0.05 μM.
    BMS-986188
  • HY-121736
    AGI-12026 1446501-77-4
    AGI-12026 is brain-penetrant dual inhibitor of mutant IDH1 and 2. AGI-12026 shows partial inhibition of the IDH1-R132H homodimer as allosteric modulators. AGI-12026 has the potential for research of glioma.
    AGI-12026
  • HY-135154
    epi-Aszonalenin A 908853-14-5
    epi-Aszonalenin A is a benzodiazepine fungal metabolite originally isolated from Aspergillus novofumigatus. epi-Aszonalenin A can be used as a psychoactive agent.
    epi-Aszonalenin A
  • HY-B0114S
    Oxcarbazepine-D4 1020719-71-4
    Oxcarbazepine-d4 (GP 47680-D4) is the deuterium labeled Oxcarbazepine. Oxcarbazepine is a sodium channel blocker[1]. Oxcarbazepine significantly inhibits glioblastoma cell growth and induces apoptosis or G2/M arrest in glioblastoma cell lines[2]. Anti-cancer and anticonvulsant effects[2][3].
    Oxcarbazepine-D4
  • HY-B0233S
    Isradipine-d3 1189959-59-8
    Isradipine-d3 (PN 200-110-d3) is the deuterium labeled Isradipine. Isradipine (PN 200-110) is an orally active L-type calcium channel blocker. Isradipine, as a powerful peripheral vasodilator, is a dihydropyridine calcium antagonist with selective actions on the heart as well as the peripheral circulation. Isradipine is a potentially viable neuroprotective agent for Parkinson's disease[1][2][3].
    Isradipine-d3
  • HY-B0374S
    Moxonidine-d4 1794811-52-1
    Moxonidine-d4 (BDF5895-d4) is the deuterium labeled Moxonidine. Moxonidine(BDF5895) is a selective agonist at the imidazoline receptor subtype 1, used as antihypertensive agent[1][2].
    Moxonidine-d4
  • HY-B0411S
    Domperidone-d6 1329614-18-7
    Domperidone-d6 is the deuterium labeled Domperidone. Domperidone (R33812) is a selective dopamine-2 receptor antagonist. Domperidone acts as an antiemetic and a prokinetic agent through its effects on the chemoreceptor trigger zone and motor function of the stomach and small intestine[1][2].
    Domperidone-d6
  • HY-B0444S
    Maprotiline-d5 hydrochloride 1794942-12-3
    Maprotiline-d5 (hydrochloride) is the deuterium labeled Maprotiline hydrochloride. Maprotiline hydrochloride is a selective noradrenalin re-uptake inhibitor and a tetracyclic antidepressant[1][2].
    Maprotiline-d5 hydrochloride
  • HY-B0949S
    Protriptyline (N-methyl-d3) (hydrochloride) 1435934-21-6
    Protriptyline (N-methyl-d3) (hydrochloride) is the deuterium labeled Protriptyline hydrochloride. Protriptyline hydrochloride is a tricyclic antidepressant (TCA), specifically a secondary amine, for the treatment of depression and ADHD. Unique among the TCAs, protriptyline tends to be energizing instead of sedating, used for narcolepsy to achieve a wakefulness-promoting effect[1].
    Protriptyline (N-methyl-d3) (hydrochloride)
  • HY-B1052S
    Lofexidine-d4 hydrochloride 1206845-57-9
    Lofexidine-d4 (hydrochloride) (Baq-168-d4) is the deuterium labeled Lofexidine hydrochloride. Lofexidine hydrochloride is a selective α2-receptor agonist, commonly used to alleviate the physical symptoms of heroin and other types of opioid withdrawal[1][2].
    Lofexidine-d4 hydrochloride
  • HY-B1213S
    Trimipramine-d3 maleate 1185245-93-5
    Trimipramine-d3 (maleate) is the deuterium labeled Trimipramine maleate. Trimipramine maleate is a 5-HT receptor antagonist, with pKis of 6.39, 8.10, 4.66 for 5-HT1C, 5-HT2 and 5-HT1A, respectively[1][2].
    Trimipramine-d3 maleate
  • HY-N10356
    4,27-Dimethyl withaferin A 1777780-95-6
    4,27-Dimethyl withaferin A is a synthetic analog of withanolide natural products. 4,27-Dimethyl withaferin A has the potential for the research of neurodegenerative diseases (extracted from patent WO2015077780A1).
    4,27-Dimethyl withaferin A
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-Y0304R
    Dibutyl phthalate (Standard) 84-74-2
    Dibutyl phthalate (Standard) is the analytical standard of Dibutyl phthalate. This product is intended for research and analytical applications. Dibutyl phthalate is a commonly used plasticizer commonly found in some food packaging materials, personal care products, and the coating of oral medications. May cause toxicity and adverse neurobehavioral effects.
    Dibutyl phthalate (Standard)
  • HY-B0031S2
    Quetiapine-d8 fumarate 1185247-12-4
    Quetiapine-d8 (fumarate) is the deuterium labeled Quetiapine. Quetiapine is a 5-HT receptors agonist with a pEC50 of 4.77 for human 5-HT1A receptor. Quetiapine is a dopamine receptor antagonist with a pIC50 of 6.33 for human D2 receptor. Quetiapine has moderate to high affinity for the human D2, HT1A, 5-HT2A, 5-HT2C receptor with pKis of 7.25, 5.74, 7.54, 5.55. Antidepressant and anxiolytic effects[1][2].
    Quetiapine-d8 fumarate
  • HY-B0196AS
    Venlafaxine-d10 hydrochloride 1216539-56-8
    Venlafaxine-d10 (hydrochloride) is the deuterium labeled Venlafaxine hydrochloride. Venlafaxine (Wy 45030) hydrochloride is an orally active, potent serotonin (5-HT)/norepinephrine (NE) reuptake dual inhibitor. Venlafaxine is an antidepressant[1][2].
    Venlafaxine-d10 hydrochloride
  • HY-B0262S1
    Methocarbamol-d3 1346600-86-9 98.15%
    Methocarbamol-d3 is the deuterium labeled Methocarbamol. Methocarbamol is an orally active central muscle relaxant and blocks muscular Nav1.4 channel. Methocarbamol reversibly affects voltage dependence of inactivation of Nav1.4 channel. Methocarbamol has the potential for muscle spasms and pain syndromes research[1][2][3].
    Methocarbamol-d3
  • HY-10847
    SB-277011 215803-78-4
    SB-277011 is a potent and delective dopamine D3 receptor antagonist (pKi values are 8.0, 6.0, 5.0 and <5.2 for D3, D2, 5-HT1D and 5-HT1B respectively); brain penetrant.
    SB-277011
  • HY-A0040
    Talipexole 101626-70-4
    Talipexole (B-HT920) is a dopamine agonist that has been proposed as an antiparkinsonian agent.
    Talipexole
  • HY-N0788
    Indaconitine 4491-19-4 ≥99.0%
    Indaconitine is a natural product.
    Indaconitine
Cat. No. Product Name / Synonyms Application Reactivity